DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1mu and ap5m1

DIOPT Version :9

Sequence 1:NP_649906.1 Gene:AP-1mu / 41150 FlyBaseID:FBgn0024833 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_005158951.1 Gene:ap5m1 / 553681 ZFINID:ZDB-GENE-050522-231 Length:492 Species:Danio rerio


Alignment Length:335 Identity:73/335 - (21%)
Similarity:121/335 - (36%) Gaps:84/335 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 LDELLDF-----GYPQ---------TTDSKILQEYITQEGHKLELQP---RIPVAVT-------N 157
            |..|.||     |.|:         ...|.:||  :...|..|::.|   .:|.||.       .
Zfish   136 LSGLQDFLCGSGGKPEPDVLASRLGALPSVLLQ--VCPLGRPLDIPPPSGLVPSAVAPSPGGAQK 198

  Fly   158 AVSWRSEGIKYRKNEVFLDVIESVNLLANANGNVLRSEI---VGAIKMRVYLSG-MPELRLGLND 218
            ..:|:: |:...:..|.:.:.|.|..:  ..|...|.:|   .|.:..:..:.| :|.:.:.|. 
Zfish   199 QPAWKA-GVHRGRAVVSVALTEKVRSM--QYGKSSRQDIWDVYGVVMCKCEVEGVLPNVTVTLT- 259

  Fly   219 KVLFESTGRGKSKSVELEDVKFHQCV---------RLSRFENDRT-------ISFIPPDGEFELM 267
               ....|.      .|:|:..|.||         ..|..|||.:       ..|.||...|.|.
Zfish   260 ---LPPNGS------PLQDILVHPCVTSLDASILTACSVDENDGSAFSGPYKFPFSPPLELFRLC 315

  Fly   268 SYRLNTHVKPLIWIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKF----- 327
            ||.....|.|::....:.....|.:|..::|.     ..|..|:.|.     .:|..|.|     
Zfish   316 SYTSQVPVPPILGSYQLKAEENHLKVNVVLKL-----HESVKNSFEY-----CEAHIPFFNQNLM 370

  Fly   328 -----KTTIGSCKYAPEQNAIIWTI-KSFPGGKEYLMR--AHF-GLPSVESEDNTEGKPP-IQVR 382
                 |.:.|..:.:.|:|.::|.: :.||..:|..:.  .|| |..:..|:....|... :::.
Zfish   371 GSVEVKVSSGQLEVSKEKNLLVWVLGQKFPKSREATLEGSVHFSGTVTGPSDPLCTGLTAYVKLY 435

  Fly   383 FEIPYFTTSG 392
            |.:|..|.||
Zfish   436 FRVPDLTLSG 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1muNP_649906.1 AP1_Mu_N 4..145 CDD:341439 10/41 (24%)
AP-1_Mu1A_Cterm 155..425 CDD:271166 59/280 (21%)
ap5m1XP_005158951.1 AP_MuD_MHD 200..484 CDD:271164 58/269 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0937
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.