DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1mu and stnB

DIOPT Version :9

Sequence 1:NP_649906.1 Gene:AP-1mu / 41150 FlyBaseID:FBgn0024833 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster


Alignment Length:429 Identity:87/429 - (20%)
Similarity:154/429 - (35%) Gaps:102/429 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VFLHKIAQVFVEYFKELEEESIRDNFVIIYE-LLDELLDFG-YPQTTDSKILQEY---ITQEGHK 144
            :|..|:..:|.:     |...:|...|...| :.::|..|. |....|.:.::|:   :.:.|..
  Fly   800 IFTMKLQYIFYK-----ERPGVRPGQVTKAERITNKLTKFAQYAIAGDYEGVKEFGSDLKKLGLP 859

  Fly   145 LELQPR---------------------IPVAVTNAVSWRSEGIKYRKNEVFLDVIESVNLLANAN 188
            :|..|:                     |..|:....:.|...:.|:..||.:..::.:.:..:..
  Fly   860 VEHAPQSSQLFKIGSMNYEDMKQFSVCIEEALFKIPALRERALTYKMEEVQVTAVDEITVEQDFE 924

  Fly   189 GNVLRSEIVGAIKMRVYLSGMPELRLGLND--KVLFESTGR------GKSKSVELEDVKFHQCVR 245
            |.:|:......:....:|:|||.:.||:||  :...|..||      ...:.:.||.|:||..|.
  Fly   925 GKILKQIARVRLFFLAFLTGMPTIELGVNDMWRQGKEVVGRHDIIPVATEEWIRLEAVEFHSVVN 989

  Fly   246 LSRFENDRTISFIPPDGEF-ELMSYRL-------------------------------------- 271
            ...:|..|||.|.|||..: ||:.:|:                                      
  Fly   990 QKEYERTRTIKFQPPDANYIELLRFRVRPPKNRELPLQLKATWCVSGNKVELRADILVPGFTSRK 1054

  Fly   272 -------NTHVK---PLIWIESV-IERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSP 325
                   :..|:   |..||... :|:|....     ..||..:|......:|.::.........
  Fly  1055 LGQIPCEDVSVRFPIPECWIYLFRVEKHFRYG-----SVKSAHRRTGKIKGIERILGAVDTLQES 1114

  Fly   326 KFKTTIGSCKYAPEQNAIIWTIKSFP--GGKEYLMRAHFGLPSVESEDN--TEGKPPIQVRFEIP 386
            ..:.|.|..||.....||:|.....|  |...|.........::.|.|.  :|..|...|.|.:|
  Fly  1115 LIEVTSGQAKYEHHHRAIVWRCPRLPKEGQGAYTTHQLVCRMALTSYDQIPSELAPYAFVEFTMP 1179

  Fly   387 YFTTSGIQVRYLKIIEKSGYQALP--WVRYITQNGDYQL 423
            ....|...||.:.:.:..|.:. |  :|||:.:: :|::
  Fly  1180 ATQVSHTTVRSVSVQDSDGDEP-PEKYVRYLARH-EYKV 1216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1muNP_649906.1 AP1_Mu_N 4..145 CDD:341439 13/64 (20%)
AP-1_Mu1A_Cterm 155..425 CDD:271166 70/333 (21%)
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603
AP_MHD_Cterm 897..1219 CDD:299401 70/327 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10529
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.