DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1mu and cm

DIOPT Version :9

Sequence 1:NP_649906.1 Gene:AP-1mu / 41150 FlyBaseID:FBgn0024833 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001259302.1 Gene:cm / 31647 FlyBaseID:FBgn0000330 Length:415 Species:Drosophila melanogaster


Alignment Length:458 Identity:127/458 - (27%)
Similarity:217/458 - (47%) Gaps:85/458 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AIFVLDVKGKVLISRNYRGDNIDMAVIDKFMPLLMEREEEGLITPILQTAETTFAYIKTNNLYIV 69
            ::|:::..|:|.:.:::| ..:..:|.:.|:.  .:|.....:.|::.|.......::.:.:.:|
  Fly     4 SLFIVNSGGEVFLEKHWR-SVVSRSVCEYFLD--AQRAAPYDVPPVIATPHYYLITVQRDTVSLV 65

  Fly    70 STTPRNKNVNIALVFVFLHKIAQVFVEYFKELEEESIRDNFVIIYELLDELLDFGYPQTTDSKIL 134
            :..  .:.|....|..|||::...|.:||.:..|..|:||:|::||||||:||.|:|..|:|.||
  Fly    66 AAC--KQEVPPLFVIEFLHRVVDTFQDYFGDCSESVIKDNYVVVYELLDEMLDNGFPLATESNIL 128

  Fly   135 QEYI-----------TQEGHKLELQPRIPVAVTNAVSWRSEGIKYRKNEVFLDVIESVNLLANAN 188
            :|.|           |..| |..:...:|....:||.||..|::|..||.:.||||.|:.:.:.:
  Fly   129 KELIKPPNILRTIANTVTG-KSNVSTTLPSGQLSAVRWRRSGVRYTNNEAYFDVIEEVDAIIDKS 192

  Fly   189 GNVLRSEIVGAIKMRVYLSGMPELRLGLNDKVLFESTGRGKSKSVELEDVKFHQCVRLSRFENDR 253
            |:.:.:||.|.|...:.|||||:|.|...:..||             :||.||.|||..|:|.:|
  Fly   193 GSTVFAEIQGHIDCCIKLSGMPDLTLSFMNPRLF-------------DDVSFHPCVRYKRWEAER 244

  Fly   254 TISFIPPDGEFELMSYRLNTHVKPLIWIESVIERHAHSRVEYMIKAKSQFK-------RRS---T 308
            .:|||||||.|.||||.:::        :||:....:.|..:.||...|.:       |.:   |
  Fly   245 LLSFIPPDGNFRLMSYHISS--------QSVVAIPIYIRHNFSIKTGEQGRLDLTIGPRNTLGRT 301

  Fly   309 ANNVEIVIPVPADADSPKFKTTIGSCKYAPEQ---------NAIIWTIKSFPGGKEYLMRAHFGL 364
            .:.|::.:.:|         ..:.:|...|.|         ..:.|.:......|         |
  Fly   302 VDKVKLELTMP---------RCVLNCLLTPNQGKYTFDSVTKTLSWDVGRIDVSK---------L 348

  Fly   365 PSVESE-------DNTEGKPPIQVRFEIPYFTTSGIQVRYLKII-EKSGYQALPWVRYITQNGDY 421
            |::...       .|.:..|.:.|:|:|.....||::|..|.:. ||  |:....|:|:|:.|.:
  Fly   349 PNIRGSVSITPGTTNIDANPSVNVQFQISQLAVSGLKVNRLDMYGEK--YKPFKGVKYLTKAGKF 411

  Fly   422 QLR 424
            |:|
  Fly   412 QVR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1muNP_649906.1 AP1_Mu_N 4..145 CDD:341439 41/150 (27%)
AP-1_Mu1A_Cterm 155..425 CDD:271166 84/297 (28%)
cmNP_001259302.1 AP_MHD_Cterm 163..414 CDD:299401 82/291 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10529
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.