DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1mu and Ap2m1

DIOPT Version :9

Sequence 1:NP_649906.1 Gene:AP-1mu / 41150 FlyBaseID:FBgn0024833 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_446289.1 Gene:Ap2m1 / 116563 RGDID:620135 Length:435 Species:Rattus norvegicus


Alignment Length:437 Identity:179/437 - (40%)
Similarity:271/437 - (62%) Gaps:25/437 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFVLDVKGKVLISRNYRGDNIDMAVIDKFMPLLMEREEEGLITPILQTAETTFAYIKTNNLYIVS 70
            :|:.:.||:|||||.|| |:|....:|.|...::...:: :.:|:...|.|:|.::|.:|:::.:
  Rat     5 LFIYNHKGEVLISRVYR-DDIGRNAVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRSNIWLAA 67

  Fly    71 TTPRNKNVNIALVFVFLHKIAQVFVEYFKELEEESIRDNFVIIYELLDELLDFGYPQTTDSKILQ 135
            .|  .:|||.|:||.||:|:..|...||.::.||:|::|||:|||||||:|||||||.:::..|:
  Rat    68 VT--KQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALK 130

  Fly   136 EYITQEGHK-----LELQPRIPVAVTNAVSWRSEGIKYRKNEVFLDVIESVNLLANANGNVLRSE 195
            .:|||:|.|     .|.|.:|...||..:.||.||||||:||:||||:||||||.:..|.||.:.
  Rat   131 TFITQQGIKS
QHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAH 195

  Fly   196 IVGAIKMRVYLSGMPELRLGLNDKVLFESTGRGKS--------KSVELEDVKFHQCVRLSRFEND 252
            :.|.:.|:.|||||||.:.|:|||::.|..|:|.:        :|:.::|..||||||||:|:::
  Rat   196 VSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSE 260

  Fly   253 RTISFIPPDGEFELMSYRLNTHVKPLIWIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIP 317
            |:|||||||||||||.||....:.....:..::.....:::|..:..||.||....|..:|:.||
  Rat   261 RSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIP 325

  Fly   318 VPADADSPKFKTTIGSCKYAPEQNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNTE-GKPPIQV 381
            .|.:....:.....|..||...:|||:|.||...|.||..:.|...|  :.:.|..: .:|||.:
  Rat   326 TPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIEL--LPTNDKKKWARPPISM 388

  Fly   382 RFEIPYFTTSGIQVRYLKIIEK----SGYQALPWVRYITQNGDYQLR 424
            .||:| |..||::|||||:.|.    |.:..:.|||||.::|.|:.|
  Rat   389 NFEVP-FAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETR 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1muNP_649906.1 AP1_Mu_N 4..145 CDD:341439 59/143 (41%)
AP-1_Mu1A_Cterm 155..425 CDD:271166 117/283 (41%)
Ap2m1NP_446289.1 AP2_Mu_N 1..140 CDD:341440 58/138 (42%)
AP-2_Mu2_Cterm 168..434 CDD:271159 108/268 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D725236at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.