DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGEB4 and MAGE

DIOPT Version :9

Sequence 1:NP_002358.1 Gene:MAGEB4 / 4115 HGNCID:6811 Length:346 Species:Homo sapiens
Sequence 2:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster


Alignment Length:221 Identity:58/221 - (26%)
Similarity:107/221 - (48%) Gaps:16/221 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    92 ASSSQASTSTE-------RSLKDSLTRKTKMLVQFLLYKYKMKEPTTKAEMLKIISKK--YKEHF 147
            ||:|:|:.|..       :...|.:..|.:.::.::|.....|.|....:::.:...|  .|:..
  Fly     2 ASTSRAARSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRL 66

Human   148 PEIFRKVSQRTELVFGLALKEVNPTTHSYILVSMLGPNDGNQSSAWTLPRNGLLMPLLSVIFLNG 212
            |.:...:::    .||:.|..::.||.::|..:.......::.:....|:..||..:|..|||.|
  Fly    67 PLVTNLLAE----TFGIILTPLDATTKTFICTAEEPVASIHELTPAQRPQFTLLYIILMYIFLRG 127

Human   213 NCAREEEIWEFLNMLGIYDGKRHLIFG-EPRKLITQDLVQEKYL--EYQQVPNSDPPRYQFLWGP 274
            |...:.:::..|.||.||..:.|..|| ..||.|.:..|:::||  |..|:...|..:..|||||
  Fly   128 NRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGP 192

Human   275 RAHAETSKMKVLEFLAKVNDTTPNNF 300
            ||.||.:..::::|.:|:.:..|..|
  Fly   193 RAKAEFTFEQMVQFASKLLNQHPKVF 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGEB4NP_002358.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..107 5/21 (24%)
MAGE_N 5..91 CDD:289225
MAGE 129..283 CDD:279759 45/158 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..346
MAGENP_649702.2 MAGE 36..201 CDD:279759 47/168 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151950
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.