powered by:
Protein Alignment RnpS1 and AT1G79100
DIOPT Version :9
Sequence 1: | NP_649903.1 |
Gene: | RnpS1 / 41147 |
FlyBaseID: | FBgn0037707 |
Length: | 374 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_178031.2 |
Gene: | AT1G79100 / 844251 |
AraportID: | AT1G79100 |
Length: | 56 |
Species: | Arabidopsis thaliana |
Alignment Length: | 55 |
Identity: | 20/55 - (36%) |
Similarity: | 29/55 - (52%) |
Gaps: | 4/55 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 230 VTKDHVFEIFSSFGDVKNVEFPVDRFHPNFGRGVAFVEY-ATPEDCESAMKHMDG 283
:.|..||. ..||::.:|:..:|| ..|..||.|:||: |...|.|....:|||
plant 1 MAKIRVFR--GDFGEIIHVQLAIDR-AANLSRGDAYVEFKAKIADAEKPQLYMDG 52
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
59 |
1.000 |
Domainoid score |
I3895 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1524222at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003226 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.