DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RnpS1 and AT1G79100

DIOPT Version :9

Sequence 1:NP_649903.1 Gene:RnpS1 / 41147 FlyBaseID:FBgn0037707 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_178031.2 Gene:AT1G79100 / 844251 AraportID:AT1G79100 Length:56 Species:Arabidopsis thaliana


Alignment Length:55 Identity:20/55 - (36%)
Similarity:29/55 - (52%) Gaps:4/55 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 VTKDHVFEIFSSFGDVKNVEFPVDRFHPNFGRGVAFVEY-ATPEDCESAMKHMDG 283
            :.|..||.  ..||::.:|:..:|| ..|..||.|:||: |...|.|....:|||
plant     1 MAKIRVFR--GDFGEIIHVQLAIDR-AANLSRGDAYVEFKAKIADAEKPQLYMDG 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RnpS1NP_649903.1 RRM <196..>301 CDD:223796 20/55 (36%)
RRM_RNPS1 221..294 CDD:240811 20/55 (36%)
AT1G79100NP_178031.2 RRM_SF <9..52 CDD:418427 15/43 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3895
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524222at2759
OrthoFinder 1 1.000 - - FOG0003226
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.