DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RnpS1 and SRSF2

DIOPT Version :9

Sequence 1:NP_649903.1 Gene:RnpS1 / 41147 FlyBaseID:FBgn0037707 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001182356.1 Gene:SRSF2 / 6427 HGNCID:10783 Length:221 Species:Homo sapiens


Alignment Length:156 Identity:58/156 - (37%)
Similarity:71/156 - (45%) Gaps:28/156 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 IHVGRLTRNVTKDHVFEIFSSFGDVKNVEFPVDRFHPNFGRGVAFVEYATPEDCESAMKHMDGGQ 285
            :.|..||...:.|.:..:|..:|.|.:|..|.||:... .||.|||.:....|.|.||..|||..
Human    16 LKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKE-SRGFAFVRFHDKRDAEDAMDAMDGAV 79

  Fly   286 IDGQEITVSPVVLVKQRPP----MRRPSPPMRRPQNNRWRSPPQFNRFNNRGGGGGGGGGRRQSP 346
            :||:|:.|.  :....|||    .||..||.|.                    ||||.|.|.:||
Human    80 LDGRELRVQ--MARYGRPPDSHHSRRGPPPRRY--------------------GGGGYGRRSRSP 122

  Fly   347 MRNRRSPRRRSRSPIRRRRRSNSSDS 372
            .|.||| |.||||..|.|.||..|.|
Human   123 RRRRRS-RSRSRSRSRSRSRSRYSRS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RnpS1NP_649903.1 RRM <196..>301 CDD:223796 27/79 (34%)
RRM_RNPS1 221..294 CDD:240811 26/72 (36%)
SRSF2NP_001182356.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 26/72 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..221 31/77 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1169
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.