DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RnpS1 and CstF64

DIOPT Version :10

Sequence 1:NP_649903.1 Gene:RnpS1 / 41147 FlyBaseID:FBgn0037707 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster


Alignment Length:111 Identity:31/111 - (27%)
Similarity:55/111 - (49%) Gaps:4/111 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 RSRTRSPSPKQVR-IHVGRLTRNVTKDHVFEIFSSFGDVKNVEFPVDRFHPNFGRGVAFVEYATP 271
            :::.:|...|.:| :.||.:....|::.:.||||..|.|.:::...|| .....:|..|.||...
  Fly     4 KAQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDR-ESGKPKGFGFCEYKDQ 67

  Fly   272 EDCESAMKHMDGGQIDGQEITVSPVVLVKQRPPMRR--PSPPMRRP 315
            |...|||::::|.:|.|:.:.|......|.|..|::  ..|.:..|
  Fly    68 ETALSAMRNLNGYEIGGRTLRVDNACTEKSRMEMQQLLQGPQVENP 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RnpS1NP_649903.1 RRM_RNPS1 221..294 CDD:409800 22/72 (31%)
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 25/84 (30%)
CSTF2_hinge 111..190 CDD:433869 1/3 (33%)
CSTF_C 377..416 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.