DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RnpS1 and srsf2b

DIOPT Version :9

Sequence 1:NP_649903.1 Gene:RnpS1 / 41147 FlyBaseID:FBgn0037707 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_955945.2 Gene:srsf2b / 323700 ZFINID:ZDB-GENE-030131-2420 Length:220 Species:Danio rerio


Alignment Length:158 Identity:56/158 - (35%)
Similarity:72/158 - (45%) Gaps:29/158 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 IHVGRLTRNVTKDHVFEIFSSFGDVKNVEFPVDRFHPNFGRGVAFVEYATPEDCESAMKHMDGGQ 285
            :.|..||...:.:.:..:|..:|.|.:|..|.||:... .||.|||.:....|.|.||..|||..
Zfish    16 LKVDNLTYRTSPETLRRVFEKYGRVGDVYIPRDRYTKE-SRGFAFVRFHDKRDAEDAMDAMDGAI 79

  Fly   286 IDGQEITVSPVVLVKQRPPMRRPSPPMRRPQNNRWRSPPQFNRFNNRGGGG----GGGGGRRQSP 346
            :||:|:                      |.|..|:..||  :.:...||||    |||||.|:..
Zfish    80 LDGREL----------------------RVQMARYGRPP--DSYYGGGGGGRRGSGGGGGSRRHG 120

  Fly   347 MRNRRSPRRRSRSPIRRRRRSNSSDSSR 374
            .|..||||||.||..|.|.||.|...||
Zfish   121 ARRSRSPRRRRRSRSRSRSRSRSRSRSR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RnpS1NP_649903.1 RRM <196..>301 CDD:223796 25/79 (32%)
RRM_RNPS1 221..294 CDD:240811 25/72 (35%)
srsf2bNP_955945.2 RRM <5..>91 CDD:223796 27/97 (28%)
RRM_SRSF2_SRSF8 16..88 CDD:240757 26/94 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1169
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.