DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RnpS1 and Pabpn1l

DIOPT Version :9

Sequence 1:NP_649903.1 Gene:RnpS1 / 41147 FlyBaseID:FBgn0037707 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001107251.1 Gene:Pabpn1l / 307920 RGDID:1562761 Length:269 Species:Rattus norvegicus


Alignment Length:303 Identity:60/303 - (19%)
Similarity:94/303 - (31%) Gaps:122/303 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SSDSDRSEKNRRRGGGAAGK-DKDKDKPSARSRSRSRTR----------SPRRVSKS-------- 132
            |||.:      .:|.||.|: :|....|||.|...:...          .|..::||        
  Rat    22 SSDPE------AQGWGAWGRTEKTSLVPSAGSDKEAEENEDSSFLLSLLEPENLAKSPVYNQELE 80

  Fly   133 ---------------PRPGSKARKEPERDRDRRSRSRDRARRAGSNDRAAADSNNVKRERSRSAS 182
                           |.|.|..||..|.:|                               ..|.
  Rat    81 AIRLKLWTMEHAEVLPEPPSVQRKATEEER-------------------------------AEAR 114

  Fly   183 RSRSPRRRG---RGSVERTPPPKRRERSRSRTRSPSPKQVRIHVGRLTRNVTKDHVFEIFSSFGD 244
            ...||...|   .|:      ||....:..|:         ::||.:....:...:...||..|:
  Rat   115 ELLSPETIGCFFPGA------PKENVEADHRS---------VYVGNVDYGGSAAELEAYFSPCGE 164

  Fly   245 VKNVEFPVDRF--HPNFGRGVAFVEYATPEDCESAMKHMDGGQIDGQEITVSP------------ 295
            :..|....|:|  ||   :|.|::|:|:....::|:: :|.....|:.|.|.|            
  Rat   165 IHRVTILCDKFSGHP---KGYAYIEFASKSSVQAAVR-LDESTFRGRVIKVLPKRTNFPGISSTD 225

  Fly   296 -----------VVLVK---QRPPMRRPSPPMR-RPQNNRWRSP 323
                       ...::   ||.|..||....| |.:.:.|.||
  Rat   226 RGGLRTHSSSRAAFLQGSLQRKPRLRPHGQSRGRGRASPWFSP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RnpS1NP_649903.1 RRM <196..>301 CDD:223796 23/132 (17%)
RRM_RNPS1 221..294 CDD:240811 18/74 (24%)
Pabpn1lNP_001107251.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..54 9/33 (27%)
RRM <129..>223 CDD:223796 23/112 (21%)
RRM_SF 140..216 CDD:302621 20/88 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..269 10/29 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.