DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RnpS1 and Sart3

DIOPT Version :9

Sequence 1:NP_649903.1 Gene:RnpS1 / 41147 FlyBaseID:FBgn0037707 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_006249563.1 Gene:Sart3 / 304582 RGDID:1311646 Length:978 Species:Rattus norvegicus


Alignment Length:237 Identity:48/237 - (20%)
Similarity:99/237 - (41%) Gaps:39/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GKDKDKDKPSARSRSRSRTRSPRRVSKSPRPGSKARKEPERDRDRRS-RSRDRA----RRAGSND 164
            |..:|.|....::.:|....:.:|:..:.:..:..::|.|:...|:. |:..:|    :..|::.
  Rat   574 GTLEDWDLAIQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQRKKVRAEKKALKKKKTRGADK 638

  Fly   165 RAAADSNNVKRERSRSASRSRSPRRRGRGS---------------------VERTPPPKRRERSR 208
            |.|.:.:: :||.........|.|||...|                     ::..||.|::|::.
  Rat   639 RKAGEDDD-ERECGEEEEEQPSKRRRMENSLASGVASAKEEETKLSGKCLTIDVAPPSKQKEKAA 702

  Fly   209 SRTR-------SPSPKQVRIHVGRLTRNVTKDHV--FEIFSSFGDVKNVEFPVDRFHPNFGRGVA 264
            |..|       ..|...|.:.|..|..::.:..|  ..:|.:.|:|..:. |:.....:| ||..
  Rat   703 SLKRDMPKVAHDSSKDSVTVFVSNLPYSIEEPEVKLRPLFEACGEVVQIR-PIFSNRGDF-RGYC 765

  Fly   265 FVEYATPEDCESAMKHMDGGQIDGQEITVSPVVLVKQRPPMR 306
            :||:...:..:.|: .:|...::|:.:.|||.|...:.|..:
  Rat   766 YVEFKEEKSAQQAL-DLDRKNVEGRPMFVSPCVDKSKNPDFK 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RnpS1NP_649903.1 RRM <196..>301 CDD:223796 27/113 (24%)
RRM_RNPS1 221..294 CDD:240811 15/74 (20%)
Sart3XP_006249563.1 RNA14 99..>477 CDD:227438
NRDE-2 350..>503 CDD:285605
RRM1_SART3 721..794 CDD:240837 15/75 (20%)
RRM2_SART3 815..895 CDD:240838
LSM_int_assoc 893..951 CDD:293211
Lsm_interact 960..977 CDD:283133
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15481
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.