DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RnpS1 and SPBC13G1.14c

DIOPT Version :9

Sequence 1:NP_649903.1 Gene:RnpS1 / 41147 FlyBaseID:FBgn0037707 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_596549.2 Gene:SPBC13G1.14c / 2539695 PomBaseID:SPBC13G1.14c Length:243 Species:Schizosaccharomyces pombe


Alignment Length:215 Identity:64/215 - (29%)
Similarity:91/215 - (42%) Gaps:50/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 NNVKRERSRSASRSRSPRRRGRGSVERTPPPKRRERSRSRTRSPSPKQVRIHVGRLTRNVTKDHV 235
            ||.:....||||||.:...|   |..|......|..|.|.:|||......|.|..|||||||:|:
pombe    54 NNTRSPSGRSASRSSNFSHR---SSSRDSFSSNRSYSSSLSRSPEEPLRTILVENLTRNVTKEHI 115

  Fly   236 FEIFSSFGDVKNVEFPVDRFHPNFGRGVAFVEYATPEDCESAMKHMDGGQIDGQEITVSPVVLVK 300
            .|||..:|.:.::..|:.: .....:|..::||...:...:|:..|:..::||:|:.||    :|
pombe   116 AEIFGIYGLIDHIFMPIYK-KSELNKGYCYIEYVYHDQAANAVDKMNNAELDGEELFVS----IK 175

  Fly   301 QRP------------PMRRPSPPMRRPQNNRWRSPPQFNRFNNRGGGGGGGGGRRQSPMRNRRSP 353
            :.|            ...|||    |.|||...:...|:|                     .|..
pombe   176 RFPFESLHKNHKHYENSYRPS----RSQNNSHYNDKSFHR---------------------SRYS 215

  Fly   354 RRRSRSPIRRRRRSNSSDSS 373
            |.|||||     .||.|:.|
pombe   216 RARSRSP-----GSNISEYS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RnpS1NP_649903.1 RRM <196..>301 CDD:223796 32/104 (31%)
RRM_RNPS1 221..294 CDD:240811 23/72 (32%)
SPBC13G1.14cNP_596549.2 RRM <94..243 CDD:223796 48/172 (28%)
RRM_RNPS1 101..173 CDD:240811 23/72 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3114
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003226
OrthoInspector 1 1.000 - - otm47053
orthoMCL 1 0.900 - - OOG6_103512
Panther 1 1.100 - - LDO PTHR15481
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1169
SonicParanoid 1 1.000 - - X3729
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.