powered by:
Protein Alignment RnpS1 and Y51H4A.23
DIOPT Version :9
Sequence 1: | NP_649903.1 |
Gene: | RnpS1 / 41147 |
FlyBaseID: | FBgn0037707 |
Length: | 374 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379270.1 |
Gene: | Y51H4A.23 / 190158 |
WormBaseID: | WBGene00013117 |
Length: | 226 |
Species: | Caenorhabditis elegans |
Alignment Length: | 64 |
Identity: | 15/64 - (23%) |
Similarity: | 24/64 - (37%) |
Gaps: | 15/64 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 263 VAFVEYATPEDCESAMKHMDGGQIDGQEITVSPVVLVKQRPPMRRPSPPMRRPQNNRWRSPPQF 326
:.:.|:. |...:|:||... |::..|...|....||...||: .|.|..:|
Worm 78 ITYFEFM----CNPFIKYMDESL-----ISIRDVATEKFLSTMRDQQPPV------SWWSTVEF 126
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
RnpS1 | NP_649903.1 |
RRM |
<196..>301 |
CDD:223796 |
7/37 (19%) |
RRM_RNPS1 |
221..294 |
CDD:240811 |
6/30 (20%) |
Y51H4A.23 | NP_001379270.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4209 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.