DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RnpS1 and EEED8.4

DIOPT Version :9

Sequence 1:NP_649903.1 Gene:RnpS1 / 41147 FlyBaseID:FBgn0037707 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_495022.2 Gene:EEED8.4 / 173921 WormBaseID:WBGene00017135 Length:191 Species:Caenorhabditis elegans


Alignment Length:181 Identity:41/181 - (22%)
Similarity:65/181 - (35%) Gaps:46/181 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 PPKRRERSRSRTRSPSPKQVRIHVGRLTRNVTKDHVFEIFSSFGDVKNVEFPVDRF---HPNFGR 261
            ||...|:.....:|       :.:|.:..|.|.:.:.|.|...|.:.....|.|:|   ..||  
 Worm    43 PPTEEEQKAIDAKS-------VFIGNVDFNSTIEEIEEHFKGCGQIVKTTIPKDKFTKKQKNF-- 98

  Fly   262 GVAFVEYATPEDCESAMKHMDGGQIDGQEITVSPVVLVKQRPPMRRPSPPMRRPQNNRWRSPPQF 326
              |::|:......|:|:      .::|......|:|:..:|..:    |.|....          
 Worm    99 --AYIEFDDSSSIENAL------VMNGSLFRSRPIVVTAKRTNI----PGMGHGV---------- 141

  Fly   327 NRFNNRGGGGGGGGGRRQSPMRNR---------RSPRRRSRSPIRRRRRSN 368
             |.::||..|.|.|..|.:|.|.:         ..|.|..|.  .|.||.|
 Worm   142 -RGSSRGTFGRGRGAARGAPGRQQTVVVKYVYVNGPNRGGRG--GRGRRFN 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RnpS1NP_649903.1 RRM <196..>301 CDD:223796 22/103 (21%)
RRM_RNPS1 221..294 CDD:240811 16/75 (21%)
EEED8.4NP_495022.2 RRM <2..>127 CDD:223796 21/100 (21%)
RRM_II_PABPs 56..128 CDD:240752 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.