DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and YBR062C

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_009618.2 Gene:YBR062C / 852354 SGDID:S000000266 Length:180 Species:Saccharomyces cerevisiae


Alignment Length:113 Identity:25/113 - (22%)
Similarity:47/113 - (41%) Gaps:19/113 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1024 SSGDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFN----------PEVHNGD---QS 1075
            :||:.:...:...||.|   |.:..|..|....:.::...|..          |.::...   ..
Yeast    46 TSGEGDAHSDSTLLLRL---LSQMLPESLQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATD 107

  Fly  1076 SCVVCMCDF---ELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGN 1120
            :|.:|..::   |...::.:..|.|:|..:|:..||..:.|||:||.|
Yeast   108 NCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDN 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 12/44 (27%)
YBR062CNP_009618.2 RING_Ubox 109..153 CDD:418438 12/43 (28%)
RING-H2 finger (C3H2C3-type) 109..152 CDD:319361 12/42 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.