DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT1G71980

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_177343.2 Gene:AT1G71980 / 843529 AraportID:AT1G71980 Length:448 Species:Arabidopsis thaliana


Alignment Length:123 Identity:40/123 - (32%)
Similarity:64/123 - (52%) Gaps:9/123 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1051 GLTRNEIDQLPSYKFNPEVH--NGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRT 1113
            |::|..:..:||..|: ..|  |....:|.:|:.|:.:...||:|||.|:|||.|||.||.|.||
plant   205 GMSRRLVKAMPSLIFS-SFHEDNTTAFTCAICLEDYTVGDKLRLLPCCHKFHAACVDSWLTSWRT 268

  Fly  1114 -CPICRGNASDYFDGVDQQQQSQATAGAAAALSGTS-----GGSAGVAGTSEASAATA 1165
             ||:|:.:|..........:.:...:.||::.:.:|     ..||.:.|.|..|..|:
plant   269 FCPVCKRDARTSTGEPPASESTPLLSSAASSFTSSSLHSSVRSSALLIGPSLGSLPTS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 22/45 (49%)
AT1G71980NP_177343.2 PA_C_RZF_like 11..161 CDD:239038
RING_Ubox 231..277 CDD:473075 23/45 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.