DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT1G68180

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001319343.1 Gene:AT1G68180 / 843146 AraportID:AT1G68180 Length:235 Species:Arabidopsis thaliana


Alignment Length:78 Identity:22/78 - (28%)
Similarity:36/78 - (46%) Gaps:17/78 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1058 DQLPSYKFNPE--------------VHNGD---QSSCVVCMCDFELRQLLRVLPCSHEFHAKCVD 1105
            |.:||.:..|.              :.:.|   :..|.:|..:||:.:..:.|.|.|.:|:.|:.
plant   102 DVMPSVQIGPPPASQSAIEAVRTVIITDEDLVKEKVCAICKEEFEVGEEGKELKCLHLYHSSCIV 166

  Fly  1106 KWLRSNRTCPICR 1118
            .||..:.||||||
plant   167 SWLNIHNTCPICR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 16/47 (34%)
AT1G68180NP_001319343.1 RING_Ubox 138..179 CDD:473075 15/40 (38%)

Return to query results.
Submit another query.