DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT1G49230

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_175349.1 Gene:AT1G49230 / 841346 AraportID:AT1G49230 Length:219 Species:Arabidopsis thaliana


Alignment Length:142 Identity:35/142 - (24%)
Similarity:60/142 - (42%) Gaps:41/142 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1018 YNQHDLSS--------GDTNETENYEALLSL--------------------------AERLGEAK 1048
            ::.||.|.        ||.|...|...:||:                          :|..|:..
plant    32 FHTHDQSPTPAPSPYVGDNNFDANVVMVLSVLLCALVCSLGLNSIIRCALRCSNLVPSEAGGDNY 96

  Fly  1049 P-----RGLTRNEIDQLPSYKFNPEVH-NGDQSSCVVCMCDFELRQLLRVLP-CSHEFHAKCVDK 1106
            |     .|:.|..:....:..::.|:: .|..:.|.:|:.:|...:.:::|| |.|.||.:|:||
plant    97 PVRLTNTGVKRKALKSFQTVSYSTELNLPGLDTECAICLSEFVAEERVKLLPTCHHGFHVRCIDK 161

  Fly  1107 WLRSNRTCPICR 1118
            ||.|:.:||.||
plant   162 WLSSHSSCPTCR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 17/45 (38%)
AT1G49230NP_175349.1 RING-H2_EL5-like 130..173 CDD:438124 17/42 (40%)

Return to query results.
Submit another query.