DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and ZNRF3

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001193927.1 Gene:ZNRF3 / 84133 HGNCID:18126 Length:936 Species:Homo sapiens


Alignment Length:122 Identity:33/122 - (27%)
Similarity:55/122 - (45%) Gaps:20/122 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1038 LSLAERLGEAKPRGLTRNEIDQLPSYKFNPE--------------VHNGDQSSCVVCMCDFELRQ 1088
            :.|.:|..:.....|....::::.:.|||.:              :.:...|.|.:|:..:...:
Human   240 IKLKQRRSQNSMNRLAVQALEKMETRKFNSKSKGRREGSCGALDTLSSSSTSDCAICLEKYIDGE 304

  Fly  1089 LLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNASDYFDGVDQQQQSQATAGAAAALS 1145
            .|||:||:|.||.||||.||..:.|||.||.|.      ::|:....|.....:.||
Human   305 ELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNI------IEQKGNPSAVCVETSNLS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 19/41 (46%)
ZNRF3NP_001193927.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
zf-RING_2 293..334 CDD:290367 19/40 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 608..693
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 739..758
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 849..875
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 892..936
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R768
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.