DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT1G35630

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_174800.2 Gene:AT1G35630 / 840463 AraportID:AT1G35630 Length:318 Species:Arabidopsis thaliana


Alignment Length:206 Identity:48/206 - (23%)
Similarity:86/206 - (41%) Gaps:63/206 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   973 NHGHRHVLPPQSLAAHQAPVQI------QATSGIIN-------------PGFLLN--------FL 1010
            |.|:..:|.|  :|.:.:.|.|      :|:..::.             |||.::        |:
plant   108 NDGYDELLVP--MAGNSSGVDIHGLLVTRASGEVLKGYADQDEMKLWLIPGFGISSWSIMGITFI 170

  Fly  1011 AMFPLSP-------YNQHDLSSGDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPE 1068
            ::..:|.       ..:|.:.....:.....:.|        ...||.|    :..:|:     |
plant   171 SLLAMSAILATCFVVRRHQIRQSVRDLPHGGQGL--------SCMPRDL----LQSMPT-----E 218

  Fly  1069 VHNG--DQSS----CVVCMCDFELRQLLRVLPCSHEFHAKCVDKWL-RSNRTCPICRGNASDYFD 1126
            |::|  ::||    |.:|:.|:.:.:.||:|||.|::||.|:|.|| |....||:|:.|..   .
plant   219 VYSGVLEESSTSVTCAICIDDYCVGEKLRILPCKHKYHAVCIDSWLGRCRSFCPVCKQNPR---T 280

  Fly  1127 GVDQQQQSQAT 1137
            |.|....|:.|
plant   281 GNDVPPASETT 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 19/46 (41%)
AT1G35630NP_174800.2 PA_C_RZF_like 11..155 CDD:239038 8/48 (17%)
zf-RING_2 232..275 CDD:290367 18/42 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.