DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT1G35330

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_174766.2 Gene:AT1G35330 / 840422 AraportID:AT1G35330 Length:328 Species:Arabidopsis thaliana


Alignment Length:167 Identity:50/167 - (29%)
Similarity:76/167 - (45%) Gaps:36/167 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   971 TANHGHRHVLPPQSLAAHQAPVQIQATSGIINPGFLLNFLAMFPL------------SPYNQHDL 1023
            :..|..|...||.   ..|.|.|:.|.  ||   .:|.|..:|.:            ||:.    
plant    26 SGQHQPRTTAPPY---IAQRPNQVPAV--II---AMLMFTLLFSMLACCVCYKYTNTSPHG---- 78

  Fly  1024 SSGDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNP----EVHNGDQSSCVVCMCDF 1084
            :|.||.|..:.|...:      ....|||.::.|:..||:.::.    ::..|. ..|.:|:.:|
plant    79 TSSDTEEGGHGEVAFT------RRTSRGLGKDVINSFPSFLYSQVKGLKIGKGG-VECAICLNEF 136

  Fly  1085 ELRQLLRVL-PCSHEFHAKCVDKWLRSNRTCPICRGN 1120
            |..:.||:: ||||.|||.|:|.||.|..|||:||.:
plant   137 EDEETLRLMPPCSHAFHASCIDVWLSSRSTCPVCRAS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 21/42 (50%)
AT1G35330NP_174766.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.