DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT1G33480

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_174614.2 Gene:AT1G33480 / 840242 AraportID:AT1G33480 Length:261 Species:Arabidopsis thaliana


Alignment Length:49 Identity:13/49 - (26%)
Similarity:22/49 - (44%) Gaps:8/49 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 DDQMRKVANKLKKFCNDSPLPKLFNQTYSNQNDTDGTLNSPDQIDRNFS 242
            ||:..:|...|.::.::..|....|      |..|..|  ||.:.|:|:
plant    74 DDKGNRVYKLLLEYASEGSLSDFMN------NCVDRKL--PDLMIRDFT 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135
AT1G33480NP_174614.2 HRD1 <76..>172 CDD:227568 11/47 (23%)
RING-H2_EL5-like 99..142 CDD:438124 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.