| Sequence 1: | NP_731367.2 | Gene: | mura / 41145 | FlyBaseID: | FBgn0037705 | Length: | 1173 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_174614.2 | Gene: | AT1G33480 / 840242 | AraportID: | AT1G33480 | Length: | 261 | Species: | Arabidopsis thaliana |
| Alignment Length: | 49 | Identity: | 13/49 - (26%) |
|---|---|---|---|
| Similarity: | 22/49 - (44%) | Gaps: | 8/49 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 194 DDQMRKVANKLKKFCNDSPLPKLFNQTYSNQNDTDGTLNSPDQIDRNFS 242 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| mura | NP_731367.2 | RING-H2_RNF38-like | 1073..1118 | CDD:438135 | |
| AT1G33480 | NP_174614.2 | HRD1 | <76..>172 | CDD:227568 | 11/47 (23%) |
| RING-H2_EL5-like | 99..142 | CDD:438124 | 7/18 (39%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||