DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment mura and RMR1

DIOPT Version :9

Sequence 1:	NP_731367.2	Gene:	mura / 41145	FlyBaseID:	FBgn0037705	Length:	1173	Species:	Drosophila melanogaster
Sequence 2:	NP_201417.1	Gene:	RMR1 / 836748	AraportID:	AT5G66160	Length:	310	Species:	Arabidopsis thaliana

Alignment Length:	63	Identity:	22/63 - (34%)
Similarity:	36/63 - (57%)	Gaps:	1/63 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly  1057 IDQLPSYKFNPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWL-RSNRTCPICR 1118
            :..||.:.|....|:....:|.:|:.|:...:.||:|||.|.||..|:|.|| :...:||:|:
plant   212 VHTLPCFTFTDSAHHKAGETCAICLEDYRFGESLRLLPCQHAFHLNCIDSWLTKWGTSCPVCK 274

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
mura	NP_731367.2	zf-RING_2	1076..1118	CDD:290367	17/42 (40%)
RMR1	NP_201417.1	PA_C_RZF_like	28..166	CDD:239038
RMR1	NP_201417.1	RING	231..277	CDD:238093	18/44 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1487241at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.920