DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and RDUF2

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001331469.1 Gene:RDUF2 / 836074 AraportID:AT5G59550 Length:512 Species:Arabidopsis thaliana


Alignment Length:70 Identity:19/70 - (27%)
Similarity:31/70 - (44%) Gaps:15/70 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 WIRK----WNPVDDDQM--RKVANKLKKFCNDSP----LPKLFNQTYSNQNDTDGTLN----SPD 235
            |.||    .:.|:|..:  ..:...|:|:|...|    |.:||.:| |.|.:....|:    .|.
plant   113 WYRKEGVGLDAVNDSFLLEASIYRILRKYCRGKPYYLSLLELFLET-SYQTELGQALDLITAQPG 176

  Fly   236 QIDRN 240
            ::|.|
plant   177 KVDLN 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135
RDUF2NP_001331469.1 zinc_ribbon_9 122..159 CDD:433910 10/37 (27%)
RING-H2_RNF126-like 303..345 CDD:438329
DUF1117 365..495 CDD:399509
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.