DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT5G43200

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_199134.1 Gene:AT5G43200 / 834338 AraportID:AT5G43200 Length:207 Species:Arabidopsis thaliana


Alignment Length:180 Identity:39/180 - (21%)
Similarity:69/180 - (38%) Gaps:53/180 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   981 PPQSLAAHQAPVQIQATSGIINPGFLLNFLAMFPLSPYNQHDLSSGDTNETENYEALLSLAERLG 1045
            |..|...|...:.:..      |.|..|.:.....:..:.||||.             .::.::.
plant    54 PDDSSTCHDPLISLTL------PSFKPNDVYQHLQTQLHDHDLSE-------------QISCKIV 99

  Fly  1046 EAKPRGLTRN-EIDQLP----------SYK-----------FNPEVHNGDQ---SSCVVCMCDFE 1085
            ||:.|..::: .:.|.|          ::|           .:.|:..|::   .:|.:|:.:..
plant   100 EAQQRQTSQSVYLPQQPPLFIIVSVKLTHKVYVVVPPLATDLDQEMSQGEEEESKTCAICLEELS 164

  Fly  1086 LRQLLRVLP-CSHEFHAKCVDKWL-RSNRTCPICRGNASDYFDGVDQQQQ 1133
            .......|| |:|.||..|:.:|| |.|.:||:||       ..||:|.|
plant   165 TSDDYCELPNCTHCFHEPCLTQWLIRGNNSCPLCR-------KPVDKQPQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 15/43 (35%)
AT5G43200NP_199134.1 RING 155..202 CDD:238093 17/53 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.