DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT5G41450

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_198960.1 Gene:AT5G41450 / 834146 AraportID:AT5G41450 Length:164 Species:Arabidopsis thaliana


Alignment Length:43 Identity:19/43 - (44%)
Similarity:27/43 - (62%) Gaps:1/43 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1077 CVVCMCDFE-LRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICR 1118
            |.:|:.:|| ..:::|:..|.|.||..|:|.||..|.|||.||
plant   110 CPICLEEFEDGHEIIRINMCRHVFHRFCIDPWLNQNLTCPNCR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 17/41 (41%)
AT5G41450NP_198960.1 RING_Ubox 110..152 CDD:473075 17/41 (41%)

Return to query results.
Submit another query.