DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT5G41440

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_198959.1 Gene:AT5G41440 / 834145 AraportID:AT5G41440 Length:124 Species:Arabidopsis thaliana


Alignment Length:52 Identity:20/52 - (38%)
Similarity:33/52 - (63%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1068 EVHNGDQSSCVVCMCDFEL-RQLLRVLPCSHEFHAKCVDKWLRSNRTCPICR 1118
            :|..||:..|.:|:.:|:: .:|:.:..|.|.||..|:..|:.:||.|||||
plant    69 DVEEGDEGCCSICLEEFKIGHELMCIKKCRHVFHRFCMLSWIDANRNCPICR 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 16/45 (36%)
AT5G41440NP_198959.1 RING_Ubox 78..123 CDD:473075 17/43 (40%)

Return to query results.
Submit another query.