DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT5G15820

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_197086.1 Gene:AT5G15820 / 831439 AraportID:AT5G15820 Length:348 Species:Arabidopsis thaliana


Alignment Length:66 Identity:19/66 - (28%)
Similarity:35/66 - (53%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1053 TRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPIC 1117
            :::.:|.||..:...|..:.....|.:|..:...::.::.|||.|.:|.:|:..||....|||:|
plant   267 SKSVVDGLPDVELTIEELSSVSIVCAICKDEVVFKEKVKRLPCKHYYHGECIIPWLGIRNTCPVC 331

  Fly  1118 R 1118
            |
plant   332 R 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 13/44 (30%)
AT5G15820NP_197086.1 RING_Ubox 291..332 CDD:473075 13/40 (33%)

Return to query results.
Submit another query.