DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and RING1

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_196600.1 Gene:RING1 / 830902 AraportID:AT5G10380 Length:301 Species:Arabidopsis thaliana


Alignment Length:172 Identity:53/172 - (30%)
Similarity:72/172 - (41%) Gaps:28/172 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   958 RTFPPHRRIPRFWTANHGHRHVLPPQSLAAHQAPVQIQATSGIINPGFLLNFLAMFPLSPYNQH- 1021
            |.:||....|.            ||:.|:. ..|..|.....||    |..||..|......|. 
plant    23 RQYPPPPPPPP------------PPRELSL-LLPTSICVVGSII----LFLFLVFFLYLHITQQR 70

  Fly  1022 -----DLSSGDTN----ETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSSC 1077
                 .::.||||    |.|..|...|....:.:....||.|:.|:.:....|.......|.:.|
plant    71 RISAASVTPGDTNQQEDEDETEERDFSDFHHVWQIPTVGLHRSAINSITVVGFKKGEGIIDGTEC 135

  Fly  1078 VVCMCDFELRQLLRVLP-CSHEFHAKCVDKWLRSNRTCPICR 1118
            .||:.:||..:.||:|| |||.||..|:|.||.|::.||:||
plant   136 SVCLNEFEEDESLRLLPKCSHAFHLNCIDTWLLSHKNCPLCR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 21/42 (50%)
RING1NP_196600.1 RING-H2_PA-TM-RING 134..177 CDD:319368 21/42 (50%)
RING-H2 finger (C3H2C3-type) 135..176 CDD:319368 21/40 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3551
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.