DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT4G09560

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_192694.2 Gene:AT4G09560 / 826540 AraportID:AT4G09560 Length:448 Species:Arabidopsis thaliana


Alignment Length:80 Identity:26/80 - (32%)
Similarity:45/80 - (56%) Gaps:10/80 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1052 LTRNEIDQLPS---YKFNPEVHNG--DQSS----CVVCMCDFELRQLLRVLPCSHEFHAKCVDKW 1107
            |..|:..::|.   .:....:.||  |:::    |.:|:.::|....||:|||.|:||..|||.|
plant   200 LNGNDFHRMPKSMIIRMPTTIFNGICDEATTSILCCICLENYEKGDKLRILPCHHKFHVACVDLW 264

  Fly  1108 LRSNRT-CPICRGNA 1121
            |...:: ||:|:.:|
plant   265 LGQRKSFCPVCKRDA 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 19/49 (39%)
AT4G09560NP_192694.2 PA_C_RZF_like 19..163 CDD:239038
RING_Ubox 234..279 CDD:473075 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.