DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT4G09560

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_192694.2 Gene:AT4G09560 / 826540 AraportID:AT4G09560 Length:448 Species:Arabidopsis thaliana


Alignment Length:80 Identity:26/80 - (32%)
Similarity:45/80 - (56%) Gaps:10/80 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1052 LTRNEIDQLPS---YKFNPEVHNG--DQSS----CVVCMCDFELRQLLRVLPCSHEFHAKCVDKW 1107
            |..|:..::|.   .:....:.||  |:::    |.:|:.::|....||:|||.|:||..|||.|
plant   200 LNGNDFHRMPKSMIIRMPTTIFNGICDEATTSILCCICLENYEKGDKLRILPCHHKFHVACVDLW 264

  Fly  1108 LRSNRT-CPICRGNA 1121
            |...:: ||:|:.:|
plant   265 LGQRKSFCPVCKRDA 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 18/46 (39%)
AT4G09560NP_192694.2 PA_C_RZF_like 19..163 CDD:239038
zf-RING_2 234..276 CDD:290367 18/41 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.