DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT4G09110

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_192650.1 Gene:AT4G09110 / 826489 AraportID:AT4G09110 Length:302 Species:Arabidopsis thaliana


Alignment Length:161 Identity:45/161 - (27%)
Similarity:67/161 - (41%) Gaps:45/161 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1000 IINPGFLLNFLAMFPLSPY--NQHDLSSGDTNE-----TENYEALLSLA---------------- 1041
            ::.|.||::.|      ||  .|.:..|.|.|.     ||...|::.||                
plant    16 VLLPLFLVHLL------PYVTCQQESESVDRNRKTNFPTETVIAIIVLAIFISLSMVACFLHKTF 74

  Fly  1042 ----------ERLGEAKPRGLTRNEIDQLPSYKFNP----EVHNGDQSSCVVCMCDFELRQLLRV 1092
                      |.......|||.:..::..|.:.::.    ::..|. ..|.:|:.:|..::.||.
plant    75 YRAEVEAASQEVFHSRARRGLEKELVESFPIFLYSEVKGLKIGKGG-VECAICLSEFVDKETLRW 138

  Fly  1093 L-PCSHEFHAKCVDKWLRSNRTCPICRGNAS 1122
            : ||||.|||.|:|.||.|..|||.||.|.|
plant   139 MPPCSHTFHANCIDVWLSSQSTCPACRANLS 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 20/42 (48%)
AT4G09110NP_192650.1 zf-RING_2 122..165 CDD:290367 20/42 (48%)
zf-rbx1 <123..165 CDD:289448 20/41 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3551
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.