DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT3G61180

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_567110.1 Gene:AT3G61180 / 825290 AraportID:AT3G61180 Length:379 Species:Arabidopsis thaliana


Alignment Length:113 Identity:38/113 - (33%)
Similarity:52/113 - (46%) Gaps:35/113 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1037 LLSLAERLGEAKPRGLTRNEIDQLPSYKF----NPEVHNG------------------------- 1072
            |.:||::      .|....||::|..:||    |.|..||                         
plant   260 LYALADQ------EGAPDEEIERLLKFKFLTVKNSEKVNGEIRETQGGIMTGLDTESQTERMLLS 318

  Fly  1073 DQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGN 1120
            :.:.|.:|:|.:|....||.|||.|.||:.|||||||.|.|||:|:.|
plant   319 EDAECSICLCAYEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFN 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 23/44 (52%)
AT3G61180NP_567110.1 RING_Ubox 322..367 CDD:473075 25/45 (56%)

Return to query results.
Submit another query.