DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT3G48030

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_190386.1 Gene:AT3G48030 / 823958 AraportID:AT3G48030 Length:349 Species:Arabidopsis thaliana


Alignment Length:121 Identity:42/121 - (34%)
Similarity:61/121 - (50%) Gaps:13/121 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1005 FLLNFLAMFPLSPYNQH-DLSSGDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKF-NP 1067
            ||.....:||:..:|.: ||.|..:.:.::   |..|.:       .||.:..||.||.:.: |.
plant   143 FLRKSSTLFPIPHFNYNPDLFSFSSPQLQH---LFFLHD-------SGLDQTAIDALPVFLYGNV 197

  Fly  1068 EVHNGDQSSCVVCMCDFELRQLLRVLP-CSHEFHAKCVDKWLRSNRTCPICRGNAS 1122
            .:.......|.||:.:|.....||:|| |||.||..|:|.||.||.|||:||.:.|
plant   198 TISLEQPFDCAVCLNEFSDTDKLRLLPVCSHAFHLHCIDTWLLSNSTCPLCRRSLS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 22/45 (49%)
AT3G48030NP_190386.1 HIG_1_N 19..69 CDD:461361
COG5540 <95..252 CDD:227827 41/118 (35%)
RING-H2_EL5-like 206..249 CDD:438124 22/42 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.