DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT3G19950

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001326918.1 Gene:AT3G19950 / 821533 AraportID:AT3G19950 Length:386 Species:Arabidopsis thaliana


Alignment Length:224 Identity:55/224 - (24%)
Similarity:88/224 - (39%) Gaps:47/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   980 LPPQSLAAHQAPVQIQATSGIINP-GFLLNFLAMF--------------PLSPYNQHDLSSGDTN 1029
            :.||:.:..|.|     .|...:| .||.|.|...              |..|.|:...:.||..
plant   165 MQPQARSTQQNP-----QSDAFDPFTFLQNHLQTLRSSGTHFEFVIENHPSDPGNRMPGNFGDYF 224

  Fly  1030 ETENYEALLSLAERLGEAKPR-----GLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDFELRQL 1089
            .....|.|:   ::|.|..|.     ..:::.||.||:.|...::...:.:.|.|||.:||....
plant   225 FGPGLEQLI---QQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSD 286

  Fly  1090 LRVLPCSHEFHAKCVDKWLRSNRTCPICRGN-ASDYFDGVDQQQQSQATAGAAAALSGT------ 1147
            ::.:||.|.||..|:..||..:.:||:||.. .:|..|..::.|.||.:.....::.|.      
plant   287 VKQMPCKHVFHQDCLLPWLELHNSCPVCRFELPTDDPDYENRSQGSQGSGDGQGSVEGQQTPRFS 351

  Fly  1148 ------------SGGSAGVAGTSEASAAT 1164
                        ||..:|..||...:..|
plant   352 IQLPWPFRRQDGSGSGSGAPGTGGGNLET 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 16/41 (39%)
AT3G19950NP_001326918.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.