DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT3G19950

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001326918.1 Gene:AT3G19950 / 821533 AraportID:AT3G19950 Length:386 Species:Arabidopsis thaliana


Alignment Length:224 Identity:55/224 - (24%)
Similarity:88/224 - (39%) Gaps:47/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   980 LPPQSLAAHQAPVQIQATSGIINP-GFLLNFLAMF--------------PLSPYNQHDLSSGDTN 1029
            :.||:.:..|.|     .|...:| .||.|.|...              |..|.|:...:.||..
plant   165 MQPQARSTQQNP-----QSDAFDPFTFLQNHLQTLRSSGTHFEFVIENHPSDPGNRMPGNFGDYF 224

  Fly  1030 ETENYEALLSLAERLGEAKPR-----GLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDFELRQL 1089
            .....|.|:   ::|.|..|.     ..:::.||.||:.|...::...:.:.|.|||.:||....
plant   225 FGPGLEQLI---QQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSD 286

  Fly  1090 LRVLPCSHEFHAKCVDKWLRSNRTCPICRGN-ASDYFDGVDQQQQSQATAGAAAALSGT------ 1147
            ::.:||.|.||..|:..||..:.:||:||.. .:|..|..::.|.||.:.....::.|.      
plant   287 VKQMPCKHVFHQDCLLPWLELHNSCPVCRFELPTDDPDYENRSQGSQGSGDGQGSVEGQQTPRFS 351

  Fly  1148 ------------SGGSAGVAGTSEASAAT 1164
                        ||..:|..||...:..|
plant   352 IQLPWPFRRQDGSGSGSGAPGTGGGNLET 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 16/44 (36%)
AT3G19950NP_001326918.1 zinc_ribbon_9 78..111 CDD:433910
RING-H2_RNF126-like 273..315 CDD:438329 16/41 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.