DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT3G13430

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_187951.1 Gene:AT3G13430 / 820543 AraportID:AT3G13430 Length:315 Species:Arabidopsis thaliana


Alignment Length:191 Identity:48/191 - (25%)
Similarity:76/191 - (39%) Gaps:59/191 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   983 QSLAAHQAPVQIQAT-SG-----IINPGF--LLNFLAMFPLSPYNQHDLSSGDTNETENYEALLS 1039
            |.:..||..|...:. ||     .|.|||  ||..||        ::||::              
plant   156 QRIRVHQDSVDTTSVPSGSLGDYFIGPGFETLLQRLA--------ENDLNN-------------- 198

  Fly  1040 LAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCV 1104
               |.|...   .|:..::.|...|....:     ..|.||:.|||:....:.:||.|:||:.|:
plant   199 ---RYGTPP---ATKEAVEALAMVKIEDSL-----LQCSVCLDDFEIGMEAKEMPCKHKFHSDCL 252

  Fly  1105 DKWLRSNRTCPICRGNASDYF--DGVDQQQQSQA-----------TAGAAAALSGTSGGSA 1152
            ..||..:.:||:||     |.  .|.|.:.::.|           .:.|:.|.:|:|..|:
plant   253 LPWLELHSSCPVCR-----YLLPTGDDDEPKTDAETSRNDDNNEDISNASMASNGSSPDSS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 16/44 (36%)
AT3G13430NP_187951.1 zinc_ribbon_9 7..40 CDD:433910
RING_Ubox 224..266 CDD:473075 16/41 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.