DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and AT3G10910

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_187702.1 Gene:AT3G10910 / 820261 AraportID:AT3G10910 Length:181 Species:Arabidopsis thaliana


Alignment Length:102 Identity:32/102 - (31%)
Similarity:50/102 - (49%) Gaps:10/102 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1018 YNQHDLSSGDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMC 1082
            :...|..|..:|...|...|         |...||.:..:.|:|...:...:.:...:.|::|:.
plant    64 FTSDDQVSNASNANANLGRL---------AAATGLKKQALKQIPVGLYGSGIIDMKATECLICLG 119

  Fly  1083 DFELRQLLRVLP-CSHEFHAKCVDKWLRSNRTCPICR 1118
            |||..:.:|||| |:|.||.:|:|.||.|..:||.||
plant   120 DFEDGEKVRVLPKCNHGFHVRCIDTWLLSRSSCPTCR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 20/45 (44%)
AT3G10910NP_187702.1 RING-H2_EL5-like 113..156 CDD:438124 20/42 (48%)

Return to query results.
Submit another query.