DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and MEE16

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_179455.1 Gene:MEE16 / 816380 AraportID:AT2G18650 Length:423 Species:Arabidopsis thaliana


Alignment Length:187 Identity:55/187 - (29%)
Similarity:84/187 - (44%) Gaps:41/187 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   981 PPQSLAAHQAPVQIQATSGIINPGF---------------LLNFLAMFPLSPYNQHDLSSGDTNE 1030
            ||..|...::...:...:..|.|..               ||:.|..|.|:|       |.::.|
plant    19 PPPPLIPLKSNTSLSNLNSKITPNILLIIIILSIIFFISGLLHILVKFLLTP-------SRESRE 76

  Fly  1031 T--ENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSS---CVVCMCDFELRQLL 1090
            .  :|..||....::|......|:.::.||.||.:.:...|  |.:.|   |.||:|:||....|
plant    77 DYFDNVTALQGQLQQLFNLHDSGVDQSLIDTLPVFHYKSIV--GLKISPFDCPVCLCEFETEDKL 139

  Fly  1091 RVLP-CSHEFHAKCVDKWLRSNRTCPICRGN-----------ASDYFDGVDQQQQSQ 1135
            |:|| |||.||.:|:|.||.|:.|||:||.|           :|.|...::.:|.|:
plant   140 RLLPKCSHAFHVECIDTWLLSHSTCPLCRSNLLSGFSSHHNLSSSYLLVLESEQSSR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 24/45 (53%)
MEE16NP_179455.1 RING-H2_PA-TM-RING 125..168 CDD:319368 23/42 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3551
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3443
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.