DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and rnf13

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_957338.1 Gene:rnf13 / 793981 ZFINID:ZDB-GENE-040426-772 Length:377 Species:Danio rerio


Alignment Length:196 Identity:52/196 - (26%)
Similarity:87/196 - (44%) Gaps:40/196 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   975 GHRHVLPPQSLAAHQAPVQIQATSGIINPGFLLNFLAMFPLSPYNQHDLSSGDTNETENYEALLS 1039
            ||..::|..||     |::......:|..|..|..:.:|.::.:.|      |.:          
Zfish   168 GHVILMPDFSL-----PLEYYLIPFLIIVGICLILIVVFMITKFVQ------DRH---------- 211

  Fly  1040 LAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQ-SSCVVCMCDFELRQLLRVLPCSHEFHAKC 1103
                  .|:...|.::::.:||.:||.    .||. ..|.:|:.::|..:.||||||||.:|.||
Zfish   212 ------RARRSRLRKDQLKKLPIHKFK----KGDSYDVCAICLDEYEEGERLRVLPCSHAYHCKC 266

  Fly  1104 VDKWL-RSNRTCPICR-------GNASDYFDGVDQQQQSQATAGAAAALSGTSGGSAGVAGTSEA 1160
            ||.|| ::.:|||:|:       |::....|.||...:....:.....|...:..||...|:..|
Zfish   267 VDPWLTKTKKTCPVCKQKVVPSDGDSESDSDSVDSGGEDNEVSENTPLLRSLASTSAHSFGSMSA 331

  Fly  1161 S 1161
            |
Zfish   332 S 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 21/42 (50%)
rnf13NP_957338.1 PA_C_RZF_like 23..180 CDD:239038 5/16 (31%)
zf-RING_2 238..282 CDD:290367 21/43 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.