DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and rnf115a

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001073542.1 Gene:rnf115a / 790928 ZFINID:ZDB-GENE-061215-82 Length:310 Species:Danio rerio


Alignment Length:189 Identity:48/189 - (25%)
Similarity:69/189 - (36%) Gaps:42/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   991 PVQIQATSGIINPGFLLNFLAM--FPLSP---------YNQHDLSSGDTNETENYEALLSLAERL 1044
            |.:..|..||:.. ||....|.  .|.||         .|..|.:.|..........||...|..
Zfish   146 PDRSPAVEGIVQQ-FLAGLFANSGVPGSPPVSWTSMLHSNPGDYAWGQGGLDAVITQLLGQFENT 209

  Fly  1045 GEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLR 1109
            |   |....:.:|..||:.....| |......|.||..|:.:.:.:|.|||:|.||:.|:..||.
Zfish   210 G---PPPAEKEKISSLPTVIITQE-HTDCNMECPVCKEDYTVGEPVRQLPCNHFFHSDCIVPWLE 270

  Fly  1110 SNRTCPICRGNASDYFDGVDQQQQSQATAGAAAALSGTSGGSAGVAGTSEASAATANPQ 1168
            .:.|||:||                          ...:|..:|...:||.|:...:|:
Zfish   271 LHDTCPVCR--------------------------KSLNGDESGTQSSSEPSSLNTDPR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 17/41 (41%)
rnf115aNP_001073542.1 zinc_ribbon_9 11..41 CDD:291067
zf-RING_2 237..279 CDD:290367 17/41 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.