DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and znrf3

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001072864.1 Gene:znrf3 / 780325 XenbaseID:XB-GENE-5937936 Length:853 Species:Xenopus tropicalis


Alignment Length:147 Identity:47/147 - (31%)
Similarity:62/147 - (42%) Gaps:37/147 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1035 EALLSLAERLGEAK---PRGLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDFELRQLLRVLPCS 1096
            :||..:..|..:||   ||..:...:|.|.|         ...|.|.:|:..:...:.|||:||:
 Frog   230 QALEKMETRKFKAKGKVPREGSCGGLDTLSS---------SSTSDCAICLEKYIDGEELRVIPCT 285

  Fly  1097 HEFHAKCVDKWLRSNRTCPICRGNASDYFDG------VD-------QQQQS------------QA 1136
            |.||.:|||.||..|.|||.||.|..:...|      |:       ||||.            |.
 Frog   286 HRFHKRCVDPWLLQNHTCPHCRHNIIEQKKGGHGPVCVENSSNRGRQQQQQRVILPVHYPGRVQR 350

  Fly  1137 TAGAAAALSGTSGGSAG 1153
            |...||..:.||.|..|
 Frog   351 TGPIAAYPTRTSMGPHG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 19/41 (46%)
znrf3NP_001072864.1 ZNRF_3_ecto 74..180 CDD:375639
RING-H2_ZNRF3 266..309 CDD:319713 21/42 (50%)
RING-H2 finger (C3H2C3-type) 266..306 CDD:319713 19/39 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 583..629
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 650..673
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..713
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 834..853
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R768
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.