DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and Rnf148

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001178011.1 Gene:Rnf148 / 681407 RGDID:1595417 Length:316 Species:Rattus norvegicus


Alignment Length:115 Identity:30/115 - (26%)
Similarity:55/115 - (47%) Gaps:22/115 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1005 FLLNFLAMFPLSPYNQHDLSSGDTNETENYEALLS-LAERLGEAKPRGLTRNEIDQLPSYKFNPE 1068
            :|..:.|..|.:|          .:.|.....:.| :.:.:|:.:.|.|...:.:..|       
  Rat   217 YLFLYCAWRPRAP----------NSSTRRQRQIKSDVKKAIGQLQLRVLKEGDKELDP------- 264

  Fly  1069 VHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICR 1118
                ::.|||||...::.:.::|:|.|.|.||..|:|.||.::||||:|:
  Rat   265 ----NEDSCVVCFDIYKAQDVIRILTCKHFFHKTCIDPWLLAHRTCPMCK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 19/41 (46%)
Rnf148NP_001178011.1 PA_GRAIL_like 56..190 CDD:239037
zf-RING_2 267..310 CDD:290367 19/42 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.