DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and zswim2

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001093613.1 Gene:zswim2 / 561301 ZFINID:ZDB-GENE-070719-8 Length:589 Species:Danio rerio


Alignment Length:96 Identity:31/96 - (32%)
Similarity:46/96 - (47%) Gaps:9/96 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1024 SSGDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPE---VHNGDQSSCVVCMCDFE 1085
            :|.:|.:.||:....|......:..|    .:.|..||......|   :|.|.|  |.:|:..|:
Zfish   290 ASQETQKIENHITGSSSVSMSCDIVP----NHVIKSLPVITVRKESRLLHPGVQ--CRLCLSRFQ 348

  Fly  1086 LRQLLRVLPCSHEFHAKCVDKWLRSNRTCPI 1116
            |.|.:|.|||.|:||..|:|..||.:..||:
Zfish   349 LGQCIRTLPCKHKFHTGCIDPLLRVSNCCPL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 18/41 (44%)
zswim2NP_001093613.1 ZZ 233..273 CDD:294208
zf-RING_2 339..379 CDD:290367 18/41 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.