DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and rnf150a

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001139044.1 Gene:rnf150a / 559804 ZFINID:ZDB-GENE-060213-1 Length:418 Species:Danio rerio


Alignment Length:135 Identity:40/135 - (29%)
Similarity:65/135 - (48%) Gaps:27/135 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1043 RLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKW 1107
            |||:|..:.:::.::..:  .|.:.|. :.|..:|.||:.|::...::|:|||.|.||..|||.|
Zfish   234 RLGDAAKKAISKLQVRTI--RKGDKET-DSDFDNCAVCIEDYKPNDVVRILPCRHVFHRNCVDPW 295

  Fly  1108 LRSNRTCPICRGNA---------SDYFDGVDQQQQSQATAGAAAALSGTSGG--SAGVAGTSEAS 1161
            |:.:||||:|:.|.         :|..|......:             ||.|  |..|.|.||.|
Zfish   296 LQDHRTCPMCKMNILKALGIPPNTDCSDDAPPDYE-------------TSSGQPSIAVTGASEVS 347

  Fly  1162 AATAN 1166
            ...::
Zfish   348 VGESS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 20/41 (49%)
rnf150aNP_001139044.1 PA_GRAIL_like 45..180 CDD:239037
UPF0233 <194..>219 CDD:299753
zf-RING_2 263..306 CDD:290367 20/42 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.