DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and RNF181

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:XP_005264416.1 Gene:RNF181 / 51255 HGNCID:28037 Length:187 Species:Homo sapiens


Alignment Length:79 Identity:18/79 - (22%)
Similarity:27/79 - (34%) Gaps:20/79 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1016 SPYNQHDLSSGDTNETENYEALLSLA---------ERLG------EAKPRGLTRNEIDQLPSYKF 1065
            |.:::||....|..:......||.||         |.||      ...|....:..::.||.   
Human     3 SYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPR--- 64

  Fly  1066 NPEVHNGDQSSCVV 1079
              .|..|.|::..|
Human    65 --TVIRGSQAALTV 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 2/7 (29%)
RNF181XP_005264416.1 None

Return to query results.
Submit another query.