DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and rnf181

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001011200.1 Gene:rnf181 / 496625 XenbaseID:XB-GENE-964051 Length:156 Species:Xenopus tropicalis


Alignment Length:144 Identity:37/144 - (25%)
Similarity:59/144 - (40%) Gaps:26/144 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1016 SPYNQHDLSSGDTNETENYEALLSLAERL----------------GEAKPRGLTRNEIDQLPSYK 1064
            |.:::|:.......|.....|||.||..|                .:..|....:..::.||...
 Frog     3 SYFDEHNCEPTVPEEQYRQNALLELARSLLSGMDIDLGALDFTEWDQRLPPPAAKKVVESLPKVT 67

  Fly  1065 FNPEVHNGDQS-SCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNA------- 1121
            ..||  ..|.: .|.||:.:||..:.:|.|||.|.||:.|:..||....:||:||...       
 Frog    68 VTPE--QADAALKCPVCLLEFEEGETVRQLPCEHLFHSSCILPWLGKTNSCPLCRHELPTDSPEY 130

  Fly  1122 SDYFDGVDQQQQSQ 1135
            .:|....:::||.:
 Frog   131 EEYKQEKERRQQKE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 17/41 (41%)
rnf181NP_001011200.1 PEX10 <10..126 CDD:227861 32/117 (27%)
RING-H2_RNF181 78..123 CDD:319583 19/44 (43%)
RING-H2 finger (C3H2C3-type) 79..119 CDD:319583 17/39 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.