DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and rnf13

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001008015.1 Gene:rnf13 / 493377 XenbaseID:XB-GENE-954771 Length:383 Species:Xenopus tropicalis


Alignment Length:130 Identity:39/130 - (30%)
Similarity:63/130 - (48%) Gaps:10/130 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1047 AKPRGLTRNEIDQLPSYKFNPEVHNGDQ-SSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWL-R 1109
            |:...|.::::.:||.:||.    .||: ..|.||:.::|....||:|||||.:|.||||.|| :
 Frog   214 ARRNRLRKDQLKKLPIHKFK----KGDEYDVCAVCLDEYEEGDKLRILPCSHAYHCKCVDPWLTK 274

  Fly  1110 SNRTCPICR----GNASDYFDGVDQQQQSQATAGAAAALSGTSGGSAGVAGTSEASAATANPQQS 1170
            :.:|||:|:    .:..|.....|..|:....:.....|...:..|....|....|.:..|..:|
 Frog   275 TKKTCPVCKQKVVPSQGDSESDSDSSQEDNEVSENTPLLRPMASASTQSFGAISESHSQQNMMES 339

  Fly  1171  1170
             Frog   340  339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 21/42 (50%)
rnf13NP_001008015.1 PA_C_RZF_like 24..181 CDD:239038
RING_Ubox 239..284 CDD:388418 22/44 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.