DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and gzl

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster


Alignment Length:160 Identity:51/160 - (31%)
Similarity:73/160 - (45%) Gaps:38/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1052 LTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSN-RTCP 1115
            |.::.:.:||..::.....|....:||:|:.||.....||||||||.:|..|:|.||..| |.||
  Fly   210 LPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCP 274

  Fly  1116 ICR-------------------GNASDYFDGVD---QQQQ---------SQATAGAAAALSGTSG 1149
            ||:                   .|.:|..|...   ||||         |.|::...||.|.:|.
  Fly   275 ICKRKVFTKGEARASRSRQPSLDNVTDTDDDTTPLLQQQQSNGRQVGQVSSASSAGGAAGSSSSV 339

  Fly  1150 GSAGVAGTSEASA-----ATANP-QQSQAA 1173
            .:|.||||:....     |..|| ::||::
  Fly   340 AAAAVAGTTRHGTFRRGHAGRNPFEESQSS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 23/42 (55%)
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038
zf-RING_2 233..277 CDD:290367 23/43 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.