DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and rnf181

DIOPT Version :10

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_956600.1 Gene:rnf181 / 393276 ZFINID:ZDB-GENE-040426-1024 Length:156 Species:Danio rerio


Alignment Length:122 Identity:36/122 - (29%)
Similarity:53/122 - (43%) Gaps:23/122 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1016 SPYNQHDLSSGDTNETENY--EALLSLAERL----------------GEAKPRGLTRNEIDQLPS 1062
            |.:::||..  .||....|  .|||.||..|                .:..|....:..:..||.
Zfish     3 SYFDEHDCE--PTNPEGQYRQNALLELARSLMQGLDIDSGSFDLSDWDQRLPPPAAKAVVQSLPV 65

  Fly  1063 YKFNPEVHNGDQS-SCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICR 1118
            ...:||  ..|:. .|.||:.:||.::.:|.:||.|.||..|:..||....:||:||
Zfish    66 VIISPE--QADKGVKCPVCLLEFEEQESVREMPCKHLFHTGCILPWLNKTNSCPLCR 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 17/45 (38%)
rnf181NP_956600.1 RING-H2_RNF181 78..123 CDD:438331 18/43 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..156
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.