DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment mura and gol

DIOPT Version :9

Sequence 1:	NP_731367.2	Gene:	mura / 41145	FlyBaseID:	FBgn0037705	Length:	1173	Species:	Drosophila melanogaster
Sequence 2:	NP_001163300.1	Gene:	gol / 38006	FlyBaseID:	FBgn0004919	Length:	601	Species:	Drosophila melanogaster

Alignment Length:	69	Identity:	26/69 - (37%)
Similarity:	43/69 - (62%)	Gaps:	3/69 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly  1052 LTRNEIDQLPSY--KFNPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTC 1114
            :|:..|.::|:.  ||:.| .:.|...|.:|:..::....:|:|||.||||..|:|.||..:|||
  Fly   277 VTKKAIMKIPTKTGKFSDE-KDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTC 340

  Fly  1115 PICR 1118
            |:|:
  Fly   341 PMCK 344

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
mura	NP_731367.2	zf-RING_2	1076..1118	CDD:290367	18/41 (44%)
gol	NP_001163300.1	PA_GRAIL_like	73..217	CDD:239037
		UPF0233	226..>258	CDD:299753
		zf-RING_2	301..344	CDD:290367	18/42 (43%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1487241at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.920