DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mura and Rnf115

DIOPT Version :9

Sequence 1:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster
Sequence 2:XP_006233037.2 Gene:Rnf115 / 362002 RGDID:1305315 Length:423 Species:Rattus norvegicus


Alignment Length:400 Identity:95/400 - (23%)
Similarity:138/400 - (34%) Gaps:96/400 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   816 PAQARLAPCHLHGVYTQPFPAAPPPG-LAAPPLQQQHQPLIQAQQMISQATLTAQQQQRDVVAIA 879
            ||:..|. |...|    ..|..|..| ..|.||  ...||...:..::.|.|.|..:..:....|
  Rat    32 PARGCLR-CRRAG----SLPLVPGGGPRVARPL--AGGPLGAGRTHVTLAGLGAAGRPEEAATAA 89

  Fly   880 TANLGPIEAPGAHGHPHAHPHAHPHAHQLPPGIHITPLSGAAA----AAATHH------------ 928
            .|.....:...|.|.....|..||     |....:...|.|.|    |.|.|.            
  Rat    90 AAAATAAQEVAAWGGTAGRPFGHP-----PQRRKMAEASAAGADAGSAVAAHRFFCHFCKGEVNP 149

  Fly   929 --------------LHSTAAAAAAVAAGAQIT---TA----------QQILFSSDRRTFPPHRRI 966
                          :......::.:..|...|   ||          ...:|..|.|.|.....:
  Rat   150 KLPEYICPRCESGFIEEVTDDSSFLGGGGSRTDNSTATHFAELWDHLDHTMFLQDFRPFLSSNPL 214

  Fly   967 PRFWTAN-HGHR-HV------LPPQSLAAHQ-------APVQIQATSGIIN---PGFLLNFLAMF 1013
            .:...|| .||: |.      .||:.....:       .|.:..|..|||.   .||..|  :..
  Rat   215 DQDNRANERGHQTHTDFWGPSRPPRLPMTRRYRSRGSTRPDRSPAIEGIIQQIFAGFFAN--SAI 277

  Fly  1014 PLSPY----------NQHDLSSGDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPE 1068
            |.||:          |..|.:.|.|........||...|..|   |....:.:|..||:.....|
  Rat   278 PGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTG---PPPADKEKITSLPTVTVTQE 339

  Fly  1069 -VHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNASDYFDGVDQQQ 1132
             |:.|  ..|.||..|:.:.:.:|.|||:|.||:.|:..||..:.|||:||.:    .:|.|..:
  Rat   340 QVNTG--LECPVCKEDYTVEEKVRQLPCNHFFHSSCIVPWLELHDTCPVCRKS----LNGEDSTR 398

  Fly  1133 QSQATAGAAA 1142
            |:|::..:|:
  Rat   399 QTQSSEASAS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
muraNP_731367.2 zf-RING_2 1076..1118 CDD:290367 17/41 (41%)
Rnf115XP_006233037.2 zinc_ribbon_9 137..167 CDD:405118 0/29 (0%)
RING-H2_RNF115 345..391 CDD:319714 19/49 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.